Pay in 4 interest-free payments of $32.38 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
using Complement factor B antibody at 1:3000 dilution
Catalogue Numbers: E-AB-65312-60
Segregation distorter homolog
Mouse CRH (Corticotropin Releasing Hormone) ELISA Kit - RE3022M Size:48T VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPRMouse CRH (Corticotropin Releasing Hormone) ELISA Kit Sizes: 48T, 96T Catalogue Numbers: RE3022M 48, RE3022M 96 Citations, Manuals and MSDS Available upon request. Species: Mouse Alternative Names: CRF, Corticoliberin Detection method: Competitive Reaction time: 1. 5H Research Areas: Metabolic pathway; Infection immunity; Hematology; Neuroscience; Sensitivity: 0. 19 ng mL Detection Range: 0. 32 20ng mL Sample Types: Serum, Plasma, Tissue homogenate
US$ 35.00
US$ 18.00
US$ 180.00